General Information

  • ID:  hor005561
  • Uniprot ID:  P30973
  • Protein name:  GnRH-associated peptide 3
  • Gene name:  gnrh3
  • Organism:  Oncorhynchus masou (Cherry salmon) (Masu salmon)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVGELEATIRMMDTGGVMALPEETGAHIPERLRPYDVMSKKRMPHK
  • Length:  46
  • Propeptide:  MDLSSKTVVQVVMLALIAQVTFSQHWSYGWLPGGKRSVGELEATIRMMDTGGVMALPEETGAHIPERLRPYDVMSKKRMPHK
  • Signal peptide:  MDLSSKTVVQVVMLALIAQVTFS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P30973-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005561_AF2.pdbhor005561_ESM.pdb

Physical Information

Mass: 596987 Formula: C221H367N65O67S5
Absent amino acids: CFNQW Common amino acids: EM
pI: 7.7 Basic residues: 9
Polar residues: 10 Hydrophobic residues: 11
Hydrophobicity: -55.87 Boman Index: -9413
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 67.83
Instability Index: 7300.43 Extinction Coefficient cystines: 1490
Absorbance 280nm: 33.11

Literature

  • PubMed ID:  1515027
  • Title:  Characterization and localization of mRNA encoding the salmon-type gonadotrophin-releasing hormone precursor of the masu salmon.